NKIRAS2 antibody (70R-5859)

Rabbit polyclonal NKIRAS2 antibody raised against the middle region of NKIRAS2

Synonyms Polyclonal NKIRAS2 antibody, Anti-NKIRAS2 antibody, MGC74742 antibody, NKIRAS 2 antibody, Nfkb Inhibitor Interacting Ras-Like 2 antibody, NKIRAS 2, KBRAS2 antibody, DKFZP434N1526 antibody, NKIRAS-2, NKIRAS2, NKIRAS-2 antibody, kappaB-Ras2 antibody
Specificity NKIRAS2 antibody was raised against the middle region of NKIRAS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE
Assay Information NKIRAS2 Blocking Peptide, catalog no. 33R-4460, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Images

Western Blot analysis using NKIRAS2 antibody (70R-5859)

NKIRAS2 antibody (70R-5859) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKIRAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKIRAS2 antibody (70R-5859) | NKIRAS2 antibody (70R-5859) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors