NKIRAS2 antibody (70R-5860)

Rabbit polyclonal NKIRAS2 antibody raised against the C terminal of NKIRAS2

Synonyms Polyclonal NKIRAS2 antibody, Anti-NKIRAS2 antibody, DKFZP434N1526 antibody, MGC74742 antibody, NKIRAS 2, NKIRAS-2 antibody, NKIRAS-2, Nfkb Inhibitor Interacting Ras-Like 2 antibody, kappaB-Ras2 antibody, NKIRAS2, NKIRAS 2 antibody, KBRAS2 antibody
Specificity NKIRAS2 antibody was raised against the C terminal of NKIRAS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NKIRAS2 antibody was raised using the C terminal of NKIRAS2 corresponding to a region with amino acids VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Assay Information NKIRAS2 Blocking Peptide, catalog no. 33R-9632, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Images

Western Blot analysis using NKIRAS2 antibody (70R-5860)

NKIRAS2 antibody (70R-5860) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKIRAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKIRAS2 antibody (70R-5860) | NKIRAS2 antibody (70R-5860) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors