NLGN4X antibody (70R-6162)

Rabbit polyclonal NLGN4X antibody raised against the N terminal of NLGN4X

Synonyms Polyclonal NLGN4X antibody, Anti-NLGN4X antibody, HLNX antibody, NLGNX 4, NLGNX 4 antibody, KIAA1260 antibody, MGC22376 antibody, NLGNX-4, NLGNX-4 antibody, NLGN4X, AUTSX2 antibody, NLGN antibody, HNLX antibody, Neuroligin 4 X-Linked antibody, ASPGX2 antibody, NLGN4 antibody
Specificity NLGN4X antibody was raised against the N terminal of NLGN4X
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NLGN4X antibody was raised using the N terminal of NLGN4X corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN
Assay Information NLGN4X Blocking Peptide, catalog no. 33R-8532, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody

Images

Western Blot analysis using NLGN4X antibody (70R-6162)

NLGN4X antibody (70R-6162) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NLGN4X antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NLGN4X antibody (70R-6162) | NLGN4X antibody (70R-6162) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors