NLGN4X antibody (70R-6163)

Rabbit polyclonal NLGN4X antibody raised against the middle region of NLGN4X

Synonyms Polyclonal NLGN4X antibody, Anti-NLGN4X antibody, Neuroligin 4 X-Linked antibody, NLGN4 antibody, NLGN antibody, HNLX antibody, KIAA1260 antibody, NLGN4X, NLGNX-4, NLGNX 4, MGC22376 antibody, NLGNX 4 antibody, NLGNX-4 antibody, HLNX antibody, AUTSX2 antibody, ASPGX2 antibody
Specificity NLGN4X antibody was raised against the middle region of NLGN4X
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NLGN4X antibody was raised using the middle region of NLGN4X corresponding to a region with amino acids ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
Assay Information NLGN4X Blocking Peptide, catalog no. 33R-2543, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody

Images

Western Blot analysis using NLGN4X antibody (70R-6163)

NLGN4X antibody (70R-6163) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NLGN4X antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NLGN4X antibody (70R-6163) | NLGN4X antibody (70R-6163) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors