NMBR antibody (70R-5956)

Rabbit polyclonal NMBR antibody raised against the N terminal of NMBR

Synonyms Polyclonal NMBR antibody, Anti-NMBR antibody, Neuromedin B Receptor antibody
Specificity NMBR antibody was raised against the N terminal of NMBR
Cross Reactivity Human
Applications WB
Immunogen NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
Assay Information NMBR Blocking Peptide, catalog no. 33R-7356, is also available for use as a blocking control in assays to test for specificity of this NMBR antibody

Images

Western Blot analysis using NMBR antibody (70R-5956)

NMBR antibody (70R-5956) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NMBR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NMBR antibody (70R-5956) | NMBR antibody (70R-5956) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors