NMUR2 antibody (70R-5107)

Rabbit polyclonal NMUR2 antibody raised against the N terminal of NMUR2

Synonyms Polyclonal NMUR2 antibody, Anti-NMUR2 antibody, SNORF62 antibody, neuromedin S receptor antibody, NMUR 2 antibody, nmu2r antibody, NMUR 2, Neuromedin U Receptor 2 antibody, neuromedin u receptor 2 antibody, tgr-1 antibody, NMUR-2 antibody, neuromedin u receptor-type 2 antibody, NMUR2, nmu-r2 antibody, protein-coupled receptor fm4 antibody, NMUR-2
Specificity NMUR2 antibody was raised against the N terminal of NMUR2
Cross Reactivity Human
Applications WB
Immunogen NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV


Western Blot analysis using NMUR2 antibody (70R-5107)

NMUR2 antibody (70R-5107) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NMUR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NMUR2 antibody (70R-5107) | NMUR2 antibody (70R-5107) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors