NNAT antibody (70R-4515)

Rabbit polyclonal NNAT antibody raised against the middle region of NNAT

Synonyms Polyclonal NNAT antibody, Anti-NNAT antibody, Neuronatin antibody, Peg5 antibody, MGC1439 antibody
Specificity NNAT antibody was raised against the middle region of NNAT
Cross Reactivity Human
Applications WB
Immunogen NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ
Assay Information NNAT Blocking Peptide, catalog no. 33R-5614, is also available for use as a blocking control in assays to test for specificity of this NNAT antibody

Images

Western Blot analysis using NNAT antibody (70R-4515)

NNAT antibody (70R-4515) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 6 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NNAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NNAT antibody (70R-4515) | NNAT antibody (70R-4515) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors