NOC4L antibody (70R-4965)

Rabbit polyclonal NOC4L antibody

Synonyms Polyclonal NOC4L antibody, Anti-NOC4L antibody, Nucleolar Complex Associated 4 Homolog antibody, NOC4L, NOCL-4, NOCL-4 antibody, NOCL 4, NOCL 4 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen NOC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS
Assay Information NOC4L Blocking Peptide, catalog no. 33R-1802, is also available for use as a blocking control in assays to test for specificity of this NOC4L antibody

Images

Immunohistochemical staining using NOC4L antibody (70R-4965)

NOC4L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOC4L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using NOC4L antibody (70R-4965) | NOC4L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using NOC4L antibody (70R-4965) | NOC4L antibody (70R-4965) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors