NODAL antibody (70R-4026)

Rabbit polyclonal NODAL antibody

Synonyms Polyclonal NODAL antibody, Anti-NODAL antibody, MGC138230 antibody, Nodal Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH
Assay Information NODAL Blocking Peptide, catalog no. 33R-2404, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody


Western Blot analysis using NODAL antibody (70R-4026)

NODAL antibody (70R-4026) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NODAL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NODAL antibody (70R-4026) | NODAL antibody (70R-4026) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors