Noggin antibody (70R-4585)

Rabbit polyclonal Noggin antibody raised against the middle region of NOG

Synonyms Polyclonal Noggin antibody, Anti-Noggin antibody, Symphalangism 1 (proximal) antibody, SYM1 antibody, SYNS1 antibody, SYM1 antibody, SYNS 1 antibody, NOG antibody, Synostoses (multiple) syndrome 1 antibody
Specificity Noggin antibody was raised against the middle region of NOG
Cross Reactivity Human
Applications WB
Immunogen Noggin antibody was raised using the middle region of NOG corresponding to a region with amino acids GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
Assay Information Noggin Blocking Peptide, catalog no. 33R-3286, is also available for use as a blocking control in assays to test for specificity of this Noggin antibody


Western Blot analysis using Noggin antibody (70R-4585)

Noggin antibody (70R-4585) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Noggin antibody (70R-4585) | Noggin antibody (70R-4585) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors