NOL5A antibody (70R-4804)

Rabbit polyclonal NOL5A antibody

Synonyms Polyclonal NOL5A antibody, Anti-NOL5A antibody, NOLA-5 antibody, NOLA 5 antibody, NOLA-5, Nucleolar Protein 5A antibody, NOP56 antibody, NOLA 5, NOL5A, 56Kda With Kke/D Repeat antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK
Assay Information NOL5A Blocking Peptide, catalog no. 33R-10114, is also available for use as a blocking control in assays to test for specificity of this NOL5A antibody


Immunohistochemical staining using NOL5A antibody (70R-4804)

NOL5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOL5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml; IHC: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. NOL5A is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NOL5A antibody (70R-4804) | NOL5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using NOL5A antibody (70R-4804) | Western Blot showing NOL5A antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors