NOLA3 antibody (70R-3305)

Rabbit polyclonal NOLA3 antibody raised against the middle region of Nola3

Synonyms Polyclonal NOLA3 antibody, Anti-NOLA3 antibody, NOLA3, NOP10P antibody, NOLA-3 antibody, NOLA 3, NOLA 3 antibody, MGC70651 antibody, NOLA-3, NOP10 antibody
Specificity NOLA3 antibody was raised against the middle region of Nola3
Cross Reactivity Human
Applications WB
Immunogen NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
Assay Information NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody


Western Blot analysis using NOLA3 antibody (70R-3305)

NOLA3 antibody (70R-3305) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOLA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOLA3 antibody (70R-3305) | NOLA3 antibody (70R-3305) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors