NOLC1 antibody (70R-1622)

Rabbit polyclonal NOLC1 antibody raised against the C terminal of NOLC1

Synonyms Polyclonal NOLC1 antibody, Anti-NOLC1 antibody, P130 antibody, Nucleolar And Coiled-Body Phosphoprotein 1 antibody, NOPP140 antibody, NOLC 1 antibody, NOPP130 antibody, NS5ATP13 antibody, KIAA0035 antibody, NOLC 1, NOLC1, NOLC-1 antibody, NOLC-1
Specificity NOLC1 antibody was raised against the C terminal of NOLC1
Cross Reactivity Human,Mouse,Rat,Dog,Arabidopsis,Drosophila
Applications IHC, WB
Immunogen NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
Assay Information NOLC1 Blocking Peptide, catalog no. 33R-2089, is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody

Images

Western Blot analysis using NOLC1 antibody (70R-1622)

NOLC1 antibody (70R-1622) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NOLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NOLC1 antibody (70R-1622) | NOLC1 antibody (70R-1622) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using NOLC1 antibody (70R-1622) | NOLC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Immunohistochemical staining using NOLC1 antibody (70R-1622) | NOLC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors