NOMO1 antibody (70R-5291)

Rabbit polyclonal NOMO1 antibody raised against the C terminal of NOMO1

Synonyms Polyclonal NOMO1 antibody, Anti-NOMO1 antibody, PM5 antibody, NOMO1, Nodal Modulator 1 antibody, Nomo antibody, NOMO-1, NOMO-1 antibody, NOMO 1, NOMO 1 antibody
Specificity NOMO1 antibody was raised against the C terminal of NOMO1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD
Assay Information NOMO1 Blocking Peptide, catalog no. 33R-7500, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody


Western Blot analysis using NOMO1 antibody (70R-5291)

NOMO1 antibody (70R-5291) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 134 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOMO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOMO1 antibody (70R-5291) | NOMO1 antibody (70R-5291) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors