NOSIP antibody (70R-2310)

Rabbit polyclonal NOSIP antibody raised against the N terminal of NOSIP

Synonyms Polyclonal NOSIP antibody, Anti-NOSIP antibody, CGI-25 antibody, Nitric Oxide Synthase Interacting Protein antibody
Specificity NOSIP antibody was raised against the N terminal of NOSIP
Cross Reactivity Human
Applications WB
Immunogen NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ
Assay Information NOSIP Blocking Peptide, catalog no. 33R-5448, is also available for use as a blocking control in assays to test for specificity of this NOSIP antibody

Images

Western Blot analysis using NOSIP antibody (70R-2310)

NOSIP antibody (70R-2310) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOSIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOSIP negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NOSIP antibody (70R-2310) | NOSIP antibody (70R-2310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors