NOVA1 antibody (70R-5002)

Rabbit polyclonal NOVA1 antibody raised against the middle region of NOVA1

Synonyms Polyclonal NOVA1 antibody, Anti-NOVA1 antibody, Neuro-Oncological Ventral Antigen 1 antibody, NOVA-1 antibody, NOVA 1 antibody, NOVA1, NOVA-1, Nova-1 antibody, NOVA 1
Specificity NOVA1 antibody was raised against the middle region of NOVA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NOVA1 antibody was raised using the middle region of NOVA1 corresponding to a region with amino acids TNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL
Assay Information NOVA1 Blocking Peptide, catalog no. 33R-9210, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody


Western Blot analysis using NOVA1 antibody (70R-5002)

NOVA1 antibody (70R-5002) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOVA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOVA1 antibody (70R-5002) | NOVA1 antibody (70R-5002) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors