NOX1 antibody (70R-7398)

Rabbit polyclonal NOX1 antibody raised against the C terminal of NOX1

Synonyms Polyclonal NOX1 antibody, Anti-NOX1 antibody, MOX1 antibody, NOX-1, NOX 1 antibody, GP91-2 antibody, NOH1 antibody, Nadph Oxidase 1 antibody, NOX 1, NOX-1 antibody, NOX1, NOH-1 antibody
Specificity NOX1 antibody was raised against the C terminal of NOX1
Cross Reactivity Human,Dog
Applications WB
Immunogen NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Assay Information NOX1 Blocking Peptide, catalog no. 33R-8868, is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody

Images

Western Blot analysis using NOX1 antibody (70R-7398)

NOX1 antibody (70R-7398) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NOX1 antibody (70R-7398) | NOX1 antibody (70R-7398) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors