NPAL2 antibody (70R-6454)

Rabbit polyclonal NPAL2 antibody raised against the N terminal of NPAL2

Synonyms Polyclonal NPAL2 antibody, Anti-NPAL2 antibody, NPAL2, NPAL 2 antibody, FLJ13955 antibody, Nipa-Like Domain Containing 2 antibody, NPAL 2, NPAL-2 antibody, NPAL-2
Specificity NPAL2 antibody was raised against the N terminal of NPAL2
Cross Reactivity Human
Applications WB
Immunogen NPAL2 antibody was raised using the N terminal of NPAL2 corresponding to a region with amino acids AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGV
Assay Information NPAL2 Blocking Peptide, catalog no. 33R-1057, is also available for use as a blocking control in assays to test for specificity of this NPAL2 antibody


Western Blot analysis using NPAL2 antibody (70R-6454)

NPAL2 antibody (70R-6454) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPAL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NPAL2 antibody (70R-6454) | NPAL2 antibody (70R-6454) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors