NPAL2 Blocking Peptide (33R-1057)

A synthetic peptide for use as a blocking control in assays to test for specificity of NPAL2 antibody, catalog no. 70R-6454

Synonyms NPAL2 control peptide, NPAL2 antibody Blocking Peptide, Anti-NPAL2 Blocking Peptide, Nipa-Like Domain Containing 2 Blocking Peptide, FLJ13955 Blocking Peptide, NPAL2, NPAL-2, NPAL 2, NPAL-2 Blocking Peptide, NPAL 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGV
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors