NPHP1 antibody (70R-6036)

Rabbit polyclonal NPHP1 antibody

Synonyms Polyclonal NPHP1 antibody, Anti-NPHP1 antibody, NPHP1, NPHP 1 antibody, Nephronophthisis 1 antibody, NPHP-1, SLSN1 antibody, NPH1 antibody, NPHP 1, NPHP-1 antibody, JBTS4 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG
Assay Information NPHP1 Blocking Peptide, catalog no. 33R-3334, is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody

Images

Western Blot analysis using NPHP1 antibody (70R-6036)

NPHP1 antibody (70R-6036) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPHP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NPHP1 antibody (70R-6036) | NPHP1 antibody (70R-6036) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors