NPM2 antibody (70R-5531)

Rabbit polyclonal NPM2 antibody raised against the N terminal of NPM2

Synonyms Polyclonal NPM2 antibody, Anti-NPM2 antibody, Nucleophosmin/Nucleoplasmin 2 antibody, NPM-2 antibody, NPM 2, NPM2, MGC78655 antibody, NPM-2, NPM 2 antibody
Specificity NPM2 antibody was raised against the N terminal of NPM2
Cross Reactivity Human
Applications WB
Immunogen NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
Assay Information NPM2 Blocking Peptide, catalog no. 33R-4898, is also available for use as a blocking control in assays to test for specificity of this NPM2 antibody


Western Blot analysis using NPM2 antibody (70R-5531)

NPM2 antibody (70R-5531) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NPM2 antibody (70R-5531) | NPM2 antibody (70R-5531) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors