NPY1R antibody (70R-5940)

Rabbit polyclonal NPY1R antibody raised against the middle region of NPY1R

Synonyms Polyclonal NPY1R antibody, Anti-NPY1R antibody, NPYR-1 antibody, NPYR 1 antibody, NPYR-1, NPY1R, Neuropeptide Y Receptor Y1 antibody, NPYR 1, NPYR antibody
Specificity NPY1R antibody was raised against the middle region of NPY1R
Cross Reactivity Human
Applications WB
Immunogen NPY1R antibody was raised using the middle region of NPY1R corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI
Assay Information NPY1R Blocking Peptide, catalog no. 33R-9008, is also available for use as a blocking control in assays to test for specificity of this NPY1R antibody

Images

Immunohistochemical staining using NPY1R antibody (70R-5940)

NPY1R antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPY1R antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using NPY1R antibody (70R-5940) | NPY1R antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using NPY1R antibody (70R-5940) | NPY1R antibody (70R-5940) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors