NR0B1 antibody (70R-1932)

Rabbit polyclonal NR0B1 antibody raised against the N terminal of NR0B1

Synonyms Polyclonal NR0B1 antibody, Anti-NR0B1 antibody, HHG antibody, DAX1 antibody, DSS antibody, AHC antibody, AHX antibody, AHCH antibody, GTD antibody, NROB1 antibody, Nuclear Receptor Subfamily 0 Group B Member 1 antibody, DAX-1 antibody
Specificity NR0B1 antibody was raised against the N terminal of NR0B1
Cross Reactivity Human
Applications WB
Immunogen NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG
Assay Information NR0B1 Blocking Peptide, catalog no. 33R-5660, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody


Western blot analysis using NR0B1 antibody (70R-1932)

Recommended NR0B1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR0B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using NR0B1 antibody (70R-1932) | Recommended NR0B1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors