NR2E1 antibody (70R-5228)

Rabbit polyclonal NR2E1 antibody raised against the middle region of NR2E1

Synonyms Polyclonal NR2E1 antibody, Anti-NR2E1 antibody, XTLL antibody, TLX antibody, NR2E1-20, NR2E1-20 antibody, TLL antibody, Nuclear Receptor Subfamily 2 Group E Member 1 antibody, NR2E1 20, NR2E1 20 antibody, NR2E1
Specificity NR2E1 antibody was raised against the middle region of NR2E1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NR2E1 antibody was raised using the middle region of NR2E1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL
Assay Information NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody

Images

Western blot analysis using NR2E1 antibody (70R-5228)

Recommended NR2E1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR2E1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using NR2E1 antibody (70R-5228) | Recommended NR2E1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors