NR2F1 antibody (70R-1942)

Rabbit polyclonal NR2F1 antibody raised against the C terminal of NR2F1

Synonyms Polyclonal NR2F1 antibody, Anti-NR2F1 antibody, NRF1 2, NRF1-2, COUP-TFI antibody, NR2F1, NRF1 2 antibody, NR2F2 antibody, Nuclear Receptor Subfamily 2 Group F Member 1 antibody, ERBAL3 antibody, EAR-3 antibody, TFCOUP1 antibody, TCFCOUP1 antibody, SVP44 antibody, NRF1-2 antibody, EAR3 antibody
Specificity NR2F1 antibody was raised against the C terminal of NR2F1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
Assay Information NR2F1 Blocking Peptide, catalog no. 33R-9656, is also available for use as a blocking control in assays to test for specificity of this NR2F1 antibody


Western Blot analysis using NR2F1 antibody (70R-1942)

NR2F1 antibody (70R-1942) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR2F1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NR2F1 antibody (70R-1942) | NR2F1 antibody (70R-1942) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors