NRBF2 antibody (70R-4582)

Rabbit polyclonal NRBF2 antibody raised against the N terminal of NRBF2

Synonyms Polyclonal NRBF2 antibody, Anti-NRBF2 antibody, Nuclear Receptor Binding Factor 2 antibody, NRBF 2 antibody, COPR1 antibody, FLJ30395 antibody, NRBF2, NRBF-2 antibody, NRBF-2, NRBF 2, COPR2 antibody, NRBF-2 antibody, DKFZp564C1664 antibody
Specificity NRBF2 antibody was raised against the N terminal of NRBF2
Cross Reactivity Human
Applications WB
Immunogen NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL
Assay Information NRBF2 Blocking Peptide, catalog no. 33R-4448, is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody

Images

Western Blot analysis using NRBF2 antibody (70R-4582)

NRBF2 antibody (70R-4582) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRBF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NRBF2 may modulate transcriptional activation by target nuclear receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NRBF2 antibody (70R-4582) | NRBF2 antibody (70R-4582) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors