NRG1 antibody (70R-6238)

Rabbit polyclonal NRG1 antibody raised against the N terminal of NRG1

Synonyms Polyclonal NRG1 antibody, Anti-NRG1 antibody, HRG1 antibody, HRGA antibody, HGL antibody, Heregulin 1 antibody, ARIA antibody, NRG 1, NRG-1, NRG 1 antibody, NRG1, SMDF antibody, GGF antibody, Neuregulin 1 antibody, NDF antibody, HRG antibody, GGF2 antibody, NRG-1 antibody
Specificity NRG1 antibody was raised against the N terminal of NRG1
Cross Reactivity Human
Applications WB
Immunogen NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
Assay Information NRG1 Blocking Peptide, catalog no. 33R-10187, is also available for use as a blocking control in assays to test for specificity of this NRG1 antibody

Images

Western Blot analysis using NRG1 antibody (70R-6238)

NRG1 antibody (70R-6238) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuregulin 1 (NRG1) was originally identified as a 44 kDa glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NRG1 antibody (70R-6238) | NRG1 antibody (70R-6238) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors