NRG3 antibody (70R-6237)

Rabbit polyclonal NRG3 antibody raised against the middle region of NRG3

Synonyms Polyclonal NRG3 antibody, Anti-NRG3 antibody, HRG3 antibody, NRG3, pro-NRG3 antibody, NRG-3 antibody, Heregulin 3 antibody, Neuregulin 3 antibody, NRG-3, NRG 3, NRG 3 antibody
Specificity NRG3 antibody was raised against the middle region of NRG3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM
Assay Information NRG3 Blocking Peptide, catalog no. 33R-9286, is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Images

Western blot analysis using NRG3 antibody (70R-6237)

Recommended NRG3 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NRG3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using NRG3 antibody (70R-6237) | Recommended NRG3 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using NRG3 antibody (70R-6237) | Brain, cortex

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors