NSF antibody (70R-4943)

Rabbit polyclonal NSF antibody raised against the C terminal of NSF

Synonyms Polyclonal NSF antibody, Anti-NSF antibody, SKD2 antibody, N-Ethylmaleimide-Sensitive Factor antibody
Specificity NSF antibody was raised against the C terminal of NSF
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL
Assay Information NSF Blocking Peptide, catalog no. 33R-8893, is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Images

Western Blot analysis using NSF antibody (70R-4943)

NSF antibody (70R-4943) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NSF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NSF antibody (70R-4943) | NSF antibody (70R-4943) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors