NSMCE1 antibody (70R-1645)

Rabbit polyclonal NSMCE1 antibody

Synonyms Polyclonal NSMCE1 antibody, Anti-NSMCE1 antibody, NSMCE-1, NSE1 antibody, Non-Smc Element 1 Homolog antibody, NSMCE1, NSMCE 1 antibody, NSMCE 1, NSMCE-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL
Assay Information NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Images

Western Blot analysis using NSMCE1 antibody (70R-1645)

NSMCE1 antibody (70R-1645) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NSMCE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NSMCE1 antibody (70R-1645) | NSMCE1 antibody (70R-1645) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors