NSUN2 antibody (70R-2160)

Rabbit polyclonal NSUN2 antibody raised against the C terminal of NSUN2

Synonyms Polyclonal NSUN2 antibody, Anti-NSUN2 antibody, SAKI antibody, MISU antibody, Nol1/Nop2/Sun Domain Family Member 2 antibody, NSUN-2 antibody, FLJ20303 antibody, NSUN-2, NSUN 2 antibody, NSUN2, NSUN 2, TRM4 antibody
Specificity NSUN2 antibody was raised against the C terminal of NSUN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
Assay Information NSUN2 Blocking Peptide, catalog no. 33R-2934, is also available for use as a blocking control in assays to test for specificity of this NSUN2 antibody


Western Blot analysis using NSUN2 antibody (70R-2160)

NSUN2 antibody (70R-2160) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NSUN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NSUN2 antibody (70R-2160) | NSUN2 antibody (70R-2160) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors