NT5DC2 antibody (70R-4565)

Rabbit polyclonal NT5DC2 antibody raised against the N terminal of NT5DC2

Synonyms Polyclonal NT5DC2 antibody, Anti-NT5DC2 antibody, NTDC2 5, 5'-Nucleotidase Domain Containing 2 antibody, FLJ12442 antibody, NTDC2-5 antibody, NTDC2-5, NTDC2 5 antibody, NT5DC2
Specificity NT5DC2 antibody was raised against the N terminal of NT5DC2
Cross Reactivity Human
Applications WB
Immunogen NT5DC2 antibody was raised using the N terminal of NT5DC2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV
Assay Information NT5DC2 Blocking Peptide, catalog no. 33R-4135, is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Images

Western Blot analysis using NT5DC2 antibody (70R-4565)

NT5DC2 antibody (70R-4565) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NT5DC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NT5DC2 antibody (70R-4565) | NT5DC2 antibody (70R-4565) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors