NTRK3 antibody (70R-7122)

Rabbit polyclonal NTRK3 antibody raised against the C terminal of NTRK3

Synonyms Polyclonal NTRK3 antibody, Anti-NTRK3 antibody, NTRK 3 antibody, Neurotrophic Tyrosine Kinase Receptor Type 3 antibody, NTRK-3, NTRK-3 antibody, TRKC antibody, NTRK 3, NTRK3, gp145(trkC) antibody
Specificity NTRK3 antibody was raised against the C terminal of NTRK3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Assay Information NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody

Images

Western Blot analysis using NTRK3 antibody (70R-7122)

NTRK3 antibody (70R-7122) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NTRK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NTRK3 antibody (70R-7122) | NTRK3 antibody (70R-7122) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors