NTSR1 antibody (70R-6966)

Rabbit polyclonal NTSR1 antibody

Synonyms Polyclonal NTSR1 antibody, Anti-NTSR1 antibody, Neurotensin Receptor 1 antibody, NTSR 1, NTSR 1 antibody, NTSR-1 antibody, NTR antibody, NTSR1, NTSR-1
Cross Reactivity Human
Applications WB
Immunogen NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT
Assay Information NTSR1 Blocking Peptide, catalog no. 33R-2909, is also available for use as a blocking control in assays to test for specificity of this NTSR1 antibody

Images

Western Blot analysis using NTSR1 antibody (70R-6966)

NTSR1 antibody (70R-6966) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NTSR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia and antinociception.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NTSR1 antibody (70R-6966) | NTSR1 antibody (70R-6966) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors