NUBP1 antibody (70R-4539)

Rabbit polyclonal NUBP1 antibody

Synonyms Polyclonal NUBP1 antibody, Anti-NUBP1 antibody, MGC117406 antibody, NBP1 antibody, Mind Homolog E. Coli antibody, NUBP1, MGC130052 antibody, Nucleotide Binding Protein 1 antibody, NUBP-1 antibody, NUBP 1 antibody, MGC130053 antibody, NUBP-1, NUBP 1, NBP antibody
Cross Reactivity Human
Applications WB
Immunogen NUBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM
Assay Information NUBP1 Blocking Peptide, catalog no. 33R-5911, is also available for use as a blocking control in assays to test for specificity of this NUBP1 antibody


Western Blot analysis using NUBP1 antibody (70R-4539)

NUBP1 antibody (70R-4539) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NUBP1 antibody (70R-4539) | NUBP1 antibody (70R-4539) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors