NUDCD3 antibody (70R-3285)

Rabbit polyclonal NUDCD3 antibody raised against the middle region of NUDCD3

Synonyms Polyclonal NUDCD3 antibody, Anti-NUDCD3 antibody, NUDCD3, Nudc Domain Containing 3 antibody, NUDCD 3, NUDCD 3 antibody, NUDCD-3 antibody, KIAA1068 antibody, NUDCD-3, NudCL antibody
Specificity NUDCD3 antibody was raised against the middle region of NUDCD3
Cross Reactivity Human
Applications WB
Immunogen NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD
Assay Information NUDCD3 Blocking Peptide, catalog no. 33R-4441, is also available for use as a blocking control in assays to test for specificity of this NUDCD3 antibody

Images

Western Blot analysis using NUDCD3 antibody (70R-3285)

NUDCD3 antibody (70R-3285) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUDCD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain and mislocalization of the dynein complex from kinetochores.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUDCD3 antibody (70R-3285) | NUDCD3 antibody (70R-3285) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors