NUDT12 antibody (70R-1043)

Rabbit polyclonal NUDT12 antibody

Synonyms Polyclonal NUDT12 antibody, Anti-NUDT12 antibody, NUDT 12, NUDT12, NUDT-12, DKFZP761I172 antibody, NUDT-12 antibody, Nucleoside Diphosphate Linked Moiety X-Type Motif 12 antibody, Nudix 12 antibody, NUDT 12 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ
Assay Information NUDT12 Blocking Peptide, catalog no. 33R-4782, is also available for use as a blocking control in assays to test for specificity of this NUDT12 antibody

Images

Western Blot analysis using NUDT12 antibody (70R-1043)

NUDT12 antibody (70R-1043) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUDT12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NUDT12 antibody (70R-1043) | NUDT12 antibody (70R-1043) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors