NUDT21 antibody (70R-1446)

Rabbit polyclonal NUDT21 antibody

Synonyms Polyclonal NUDT21 antibody, Anti-NUDT21 antibody, NUDT-21 antibody, Nudix 21 antibody, NUDT 21, NUDT21, NUDT-21, Nucleoside Diphosphate Linked Moiety X-Type Motif 21 antibody, NUDT 21 antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
Assay Information NUDT21 Blocking Peptide, catalog no. 33R-9098, is also available for use as a blocking control in assays to test for specificity of this NUDT21 antibody


Immunohistochemical staining using NUDT21 antibody (70R-1446)

NUDT21 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUDT21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NUDT21 antibody (70R-1446) | NUDT21 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using NUDT21 antibody (70R-1446) | NUDT21 antibody (70R-1446) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors