NUP35 antibody (70R-2173)
Rabbit polyclonal NUP35 antibody raised against the C terminal of NUP35
Overview
Overview
Synonyms | Polyclonal NUP35 antibody, Anti-NUP35 antibody, NUP-35, NP44 antibody, Nucleoporin 35Kda antibody, NUP 35 antibody, NUP35, NUP-35 antibody, MP44 antibody, NUP 35 |
---|---|
Specificity | NUP35 antibody was raised against the C terminal of NUP35 |
Cross Reactivity | Human,Mouse,Rat |
Applications | WB |
Immunogen | NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW |
Assay Information | NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody |
Images
Western Blot analysis using NUP35 antibody (70R-2173)
NUP35 antibody (70R-2173) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 35 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NUP35 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product