NXF5 antibody (70R-1358)

Rabbit polyclonal NXF5 antibody raised against the middle region of NXF5

Synonyms Polyclonal NXF5 antibody, Anti-NXF5 antibody, NXF 5, NXF 5 antibody, NXF5, NXF-5, Nuclear Rna Export Factor 5 antibody, NXF-5 antibody
Specificity NXF5 antibody was raised against the middle region of NXF5
Cross Reactivity Human
Applications IHC, WB
Immunogen NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
Assay Information NXF5 Blocking Peptide, catalog no. 33R-4173, is also available for use as a blocking control in assays to test for specificity of this NXF5 antibody

Images

Western Blot analysis using NXF5 antibody (70R-1358)

NXF5 antibody (70R-1358) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NXF5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NXF5 antibody (70R-1358) | NXF5 antibody (70R-1358) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using NXF5 antibody (70R-1358) | NXF5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors