NYD-SP21 antibody (70R-6530)

Rabbit polyclonal NYD-SP21 antibody raised against the middle region of Nyd-Sp21

Synonyms Polyclonal NYD-SP21 antibody, Anti-NYD-SP21 antibody, NYD-SP 21 antibody, NYD-SP21, MGC49828 antibody, NYD-SP 21, MGC104289 antibody, NYD-SP-21, NYD-SP-21 antibody
Specificity NYD-SP21 antibody was raised against the middle region of Nyd-Sp21
Cross Reactivity Human
Applications WB
Immunogen NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV
Assay Information NYD-SP21 Blocking Peptide, catalog no. 33R-7792, is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody

Images

Western Blot analysis using NYD-SP21 antibody (70R-6530)

NYD-SP21 antibody (70R-6530) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NYD-SP21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NYD-SP21 antibody (70R-6530) | NYD-SP21 antibody (70R-6530) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors