OAS1 antibody (70R-5884)

Rabbit polyclonal OAS1 antibody raised against the C terminal of OAS1

Synonyms Polyclonal OAS1 antibody, Anti-OAS1 antibody, 2'5'-Oligoadenylate Synthetase 1 40/46Kda antibody, OAS-1, OAS1, OIAS antibody, OAS 1, IFI-4 antibody, OIASI antibody, OAS 1 antibody, OAS-1 antibody
Specificity OAS1 antibody was raised against the C terminal of OAS1
Cross Reactivity Human
Applications WB
Immunogen OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA
Assay Information OAS1 Blocking Peptide, catalog no. 33R-3670, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Images

Western Blot analysis using OAS1 antibody (70R-5884)

OAS1 antibody (70R-5884) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OAS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OAS1 antibody (70R-5884) | OAS1 antibody (70R-5884) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors