OAS1 antibody (70R-5887)

Rabbit polyclonal OAS1 antibody raised against the N terminal of OAS1

Synonyms Polyclonal OAS1 antibody, Anti-OAS1 antibody, OAS 1, OAS-1 antibody, OAS1, 2'5'-Oligoadenylate Synthetase 1 40/46Kda antibody, OIASI antibody, IFI-4 antibody, OAS 1 antibody, OAS-1, OIAS antibody
Specificity OAS1 antibody was raised against the N terminal of OAS1
Cross Reactivity Human
Applications WB
Immunogen OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS
Assay Information OAS1 Blocking Peptide, catalog no. 33R-6228, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Images

Western Blot analysis using OAS1 antibody (70R-5887)

OAS1 antibody (70R-5887) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OAS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OAS1 antibody (70R-5887) | OAS1 antibody (70R-5887) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors