OAS2 antibody (70R-5885)

Rabbit polyclonal OAS2 antibody raised against the N terminal of OAS2

Synonyms Polyclonal OAS2 antibody, Anti-OAS2 antibody, 2'-5'-Oligoadenylate Synthetase 2 69/71Kda antibody, OAS-2, MGC78578 antibody, OAS 2 antibody, OAS2, OAS 2, OAS-2 antibody
Specificity OAS2 antibody was raised against the N terminal of OAS2
Cross Reactivity Human
Applications WB
Immunogen OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL
Assay Information OAS2 Blocking Peptide, catalog no. 33R-1912, is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody

Images

Western Blot analysis using OAS2 antibody (70R-5885)

OAS2 antibody (70R-5885) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OAS2 antibody (70R-5885) | OAS2 antibody (70R-5885) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors