OASL antibody (70R-5888)

Rabbit polyclonal OASL antibody raised against the middle region of OASL

Synonyms Polyclonal OASL antibody, Anti-OASL antibody, 2'-5'-Oligoadenylate Synthetase-Like antibody, p59OASL antibody, TRIP14 antibody
Specificity OASL antibody was raised against the middle region of OASL
Cross Reactivity Human
Applications WB
Immunogen OASL antibody was raised using the middle region of OASL corresponding to a region with amino acids RGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFS
Assay Information OASL Blocking Peptide, catalog no. 33R-7944, is also available for use as a blocking control in assays to test for specificity of this OASL antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OASL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OASL does not have 2'-5'-OAS activity, but binds double-stranded RNA and DNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors