OCA2 antibody (70R-6977)

Rabbit polyclonal OCA2 antibody raised against the middle region of OCA2

Synonyms Polyclonal OCA2 antibody, Anti-OCA2 antibody, OCA-2, OCA 2, OCA-2 antibody, OCA 2 antibody, P antibody, PED antibody, EYCL3 antibody, Oculocutaneous Albinism Ii antibody, BOCA antibody, OCA2, D15S12 antibody
Specificity OCA2 antibody was raised against the middle region of OCA2
Cross Reactivity Human,Mouse
Applications WB
Immunogen OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
Assay Information OCA2 Blocking Peptide, catalog no. 33R-5036, is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody

Images

Western blot analysis using OCA2 antibody (70R-6977)

Recommended OCA2 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OCA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using OCA2 antibody (70R-6977) | Recommended OCA2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors