ODF2 antibody (70R-3915)

Rabbit polyclonal ODF2 antibody raised against the N terminal of ODF2

Synonyms Polyclonal ODF2 antibody, Anti-ODF2 antibody, ODF-2 antibody, FLJ44866 antibody, ODF 2, ODF84 antibody, Outer Dense Fiber Of Sperm Tails 2 antibody, ODF-2, ODF2/1 antibody, ODF 2 antibody, MGC9034 antibody, MGC111096 antibody, ODF2/2 antibody, ODF2
Specificity ODF2 antibody was raised against the N terminal of ODF2
Cross Reactivity Human
Applications WB
Immunogen ODF2 antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
Assay Information ODF2 Blocking Peptide, catalog no. 33R-6401, is also available for use as a blocking control in assays to test for specificity of this ODF2 antibody


Western Blot analysis using ODF2 antibody (70R-3915)

ODF2 antibody (70R-3915) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ODF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ODF2 antibody (70R-3915) | ODF2 antibody (70R-3915) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors