ODF4 antibody (70R-6942)

Rabbit polyclonal ODF4 antibody raised against the N terminal of ODF4

Synonyms Polyclonal ODF4 antibody, Anti-ODF4 antibody, ODF-4 antibody, MGC138215 antibody, OPPO1 antibody, ODF 4 antibody, ODF4, Outer Dense Fiber Of Sperm Tails 4 antibody, MGC138219 antibody, ODF-4, ODF 4
Specificity ODF4 antibody was raised against the N terminal of ODF4
Cross Reactivity Human
Applications WB
Immunogen ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
Assay Information ODF4 Blocking Peptide, catalog no. 33R-5819, is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody

Images

Western Blot analysis using ODF4 antibody (70R-6942)

ODF4 antibody (70R-6942) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ODF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ODF4 antibody (70R-6942) | ODF4 antibody (70R-6942) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors