OLAH antibody (70R-4310)

Rabbit polyclonal OLAH antibody raised against the N terminal of OLAH

Synonyms Polyclonal OLAH antibody, Anti-OLAH antibody, THEDC1 antibody, MGC51852 antibody, AURA1 antibody, Oleoyl-Acp Hydrolase antibody, FLJ11106 antibody, SAST antibody
Specificity OLAH antibody was raised against the N terminal of OLAH
Cross Reactivity Human
Applications WB
Immunogen OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
Assay Information OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody

Images

Western Blot analysis using OLAH antibody (70R-4310)

OLAH antibody (70R-4310) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OLAH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using OLAH antibody (70R-4310) | OLAH antibody (70R-4310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors