OLFM4 antibody (70R-1580)

Rabbit polyclonal OLFM4 antibody raised against the C terminal of OLFM4

Synonyms Polyclonal OLFM4 antibody, Anti-OLFM4 antibody, GW112 antibody, KIAA4294 antibody, OLFM-4, bA209J19.1 antibody, GC1 antibody, OLFM 4, OlfD antibody, Olfactomedin 4 antibody, OLFM 4 antibody, OLFM4, OLFM-4 antibody
Specificity OLFM4 antibody was raised against the C terminal of OLFM4
Cross Reactivity Human
Applications WB
Immunogen OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
Assay Information OLFM4 Blocking Peptide, catalog no. 33R-2362, is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody


Western Blot analysis using OLFM4 antibody (70R-1580)

OLFM4 antibody (70R-1580) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of OLFM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using OLFM4 antibody (70R-1580) | OLFM4 antibody (70R-1580) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors